Get UniParc Entries by Sequence
Retrieve UniParc Entry by providing an exact sequence. Note that partial matches will not be accepted. You can also filter the returned content of the returned UniParc entry. see "Argument" section for more details.
rba_uniprot_uniparc_sequence( sequence, rf_dd_type = NA, rf_db_id = NA, rf_active = NA, rf_tax_id = NA, ... )
sequence |
Exact UniParc protein sequence. Partial matches will not be accepted. |
rf_dd_type |
Filter the content of the UniParc entry by cross-reference names. You can provide multiple values. |
rf_db_id |
Filter the content of the UniParc entry by protein identifiers in any cross-reference database. You can provide multiple values. |
rf_active |
(logical ) Filter the content of UniParc entry based on active status on source database:
|
rf_tax_id |
(Numeric) Filter the content of the UniParc entry by NIH-NCBI Taxon ID. You can provide multiple values. |
... |
rbioapi option(s). Refer to |
A list which correspond to a UniParc entry.
"POST https://ebi.ac.uk/proteins/api/uniparc/sequence"
Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, The Proteins API: accessing key integrated protein and genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237
Other "UniProt - UniParc":
rba_uniprot_uniparc_bestguess()
,
rba_uniprot_uniparc_search()
,
rba_uniprot_uniparc()
rba_uniprot_uniparc_sequence("GMRSCPRGCSQRGRCENGRCVCNPGYTGEDC")
Please choose more modern alternatives, such as Google Chrome or Mozilla Firefox.